top of page

CircRNA

Gene

chr5|75381071|75386034|—|4|circRNA|COL4A3BP|ENST00000357457.8|6,5,4,3

COL4A3BP

Open Reading Frame (ORF)

MICQTLVSPPEGNQEISRDNILCKITYVANGIQKRSRRKWDCSGSFKSYPCS

Peptide

ITYVANGIQKR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page