top of page

CircRNA

Gene

chr5|74722378|74736985|—|6|circRNA|GFM2|ENST00000296805.7|20,19,18,17,16,15

GFM2

Open Reading Frame (ORF)

LQLVEPNGREKRSTDKTMKQRDFYWLEWRFQNLFSSVP

Peptide

LQLVEPNGR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page