top of page

CircRNA

Gene

chr5|71556885|71560237|+|2|circRNA|BDP1|ENST00000358731.8|36,37

BDP1

CircRNA UID

circBDP1(36,37)

Open Reading Frame (ORF)

LCLIRKKELMLLLSLSKWIAEHRLLKPHYPGALKGINKCF

Peptide

ELMLLLSLSK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page