top of page

CircRNA

Gene

chr5|69419370|69420531|+|1|circRNA|MARVELD2|ENST00000325631.9|2

MARVELD2

CircRNA UID

circMARVELD2(2)

Open Reading Frame (ORF)

LSLTPGRTFSEGRKRTPNGISRCLISGTSPMEWSVHHQPLQQDQTTVRPSTPAKIPTEGQKEPLVPGKRLTQCFPGIPMDL

Peptide

CLISGTSPMEWSVHHQPLQQDQTTVRPSTPAK

ORF Found in Long-Read

false

Peptide Length

32

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

32

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page