top of page

CircRNA

Gene

chr5|69292187|69306902|—|5|circRNA|CCDC125|ENST00000396496.6|10,9,8,7,6

CCDC125

Open Reading Frame (ORF)

LEILQKSKEEAYVMADAFRIAFEQQLMRKNDQALQLTQMDKMHKKATKWMNWKHLKEDGNKCLAVGNRI

Peptide

EDGNKCLAVGNR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA,PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page