top of page

CircRNA

Gene

chr5|65576878|65583219|+|3|circRNA|PPWD1|NM_015342|6,7,8

PPWD1

CircRNA UID

circPPWD1(6,7,8)

Open Reading Frame (ORF)

LIEMFLMRNLLKKKSWQLLKLKDLNEFRTVPLSTPAWETFTPNFFLLNVY

Peptide

LIEMFLMRNLLK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page