top of page

CircRNA

Gene

chr5|55645788|55672695|—|9|circRNA|SLC38A9|ENST00000505708.5|10,9,8,7,6,5,4,3,2

SLC38A9

Open Reading Frame (ORF)

LTGVLTLAFFIHNCIITLLKNNKKQENNAFLYRAHKHRECESCHSEG

Peptide

KQENNAFLYR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page