top of page

CircRNA

Gene

chr5|38876200|38925371|+|13|circRNA|OSMR|ENST00000274276.7|3,4,5,6,7,8,9,10,11,12,13,14,15

OSMR

Open Reading Frame (ORF)

MSFSSLHSLVLVKAPVLRSRRSRLRMNTSWLNVYH

Peptide

LRMNTSWLNVYH

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA,PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page