top of page

CircRNA

Gene

chr5|37195857|37205454|—|4|circRNA|C5orf42|ENST00000508244.5|20,19,18,17

C5orf42

Open Reading Frame (ORF)

MKGSLPSLSPFPQSLLNYCKGGIAFFRPGAAGDHKLDEVSIRAIGPRKRV

Peptide

LDEVSIRAIGPR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page