top of page

CircRNA

Gene

chr5|37173754|37175986|-|2|circRNA|C5orf42|ENST00000508244.5|31,30

C5orf42

Open Reading Frame (ORF)

MESMLLHNHLLQHLRRPREMNSRLSYQIVRSPLGRCCKMKCLN

Peptide

RPREMNSR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page