top of page

CircRNA

Gene

chr5|32363947|32390437|—|8|circRNA|ZFR|NM_016107|19,18,17,16,15,14,13,12

ZFR

Open Reading Frame (ORF)

MKRTCTGGEWRKNNIIGMIAAECQMEVILMVLQAH

Peptide

KNNIIGMIAAECQMEVILMVLQAH

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page