top of page

CircRNA

Gene

chr5|32087130|32091175|+|1|circRNA|PDZD2|ENST00000438447.1|20

PDZD2

Open Reading Frame (ORF)

LTASSRSWMLLQQGLRLPRRGTVALRRAVLRATHQPGLEVGAPAVPNQSRGARPPPRGGPGLLVPPPTHNGPPSLRF

Peptide

SWMLLQQGLR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page