top of page

CircRNA

Gene

chr5|180529274|180571432|+|10|circRNA|CNOT6|NM_001303241|4,5,6,7,8,9,10,11,12,13

CNOT6

Open Reading Frame (ORF)

LSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFKLQSAYESGLMPYTNYTFDFKACPKKNTSPLTLGGCIQLCLLRKQQMERNPTGQSLK

Peptide

LQSAYESGLMPYTNYTFDFKACPK

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page