top of page

CircRNA

Gene

chr5|176951473|176982623|-|8|circRNA|UIMC1|ENST00000377227.8|9,8,7,6,5,4,3,2

UIMC1

CircRNA UID

circUIMC1(9,8,7,6,5,4,3,2)

Open Reading Frame (ORF)

LDGVRIIMADKETKGCHGERKKLKKSPNLGTWRRRMWKLPVLSV

Peptide

KSPNLGTWR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page