top of page

CircRNA

Gene

chr5|168488601|168495436|+|5|circRNA|RARS|ENST00000231572.7|2,3,4,5,6

RARS

CircRNA UID

circRARS(2,3,4,5,6)

Open Reading Frame (ORF)

MHVGHLRSTIIGESISRLFEFAGYDVLRKKRLNL

Peptide

LFEFAGYDVLRK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page