top of page

CircRNA

Gene

chr5|168371423|168385414|+|2|circRNA|WWC1|ENST00000265293.8|2,3

WWC1

Open Reading Frame (ORF)

MLKDYLVVAQEALSAQKEIYQVKQQRLELAQQEYQQLHAVWEHKLGSQVSCTPNRSPLLTALVMSCR

Peptide

LGSQVSCTPNR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page