top of page

CircRNA

Gene

chr5|157789513|157791702|-|1|ciRNA|CLINT1|NM_014666|10

CLINT1

CircRNA UID

ciCLINT1(10)

Open Reading Frame (ORF)

LSDGRIIVSVGKLLVLSTSNLIGTSEEPLWEANDSGY

Peptide

IIVSVGKLLVLSTSNLIGTSEEPLWEANDSGY

ORF Found in Long-Read

false

Peptide Length

32

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

32

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page