top of page

CircRNA

Gene

chr5|154896091|154896343|—|1|circRNA|GEMIN5|ENST00000285873.7|24

GEMIN5

Open Reading Frame (ORF)

LQCGRASSALTPLSSIRKPFRSCRTSSTHLLQITHLPNRVRDWCFAFWSYCPGIWRKSSFQRAKAPPLTTLGTRAPKGLSWRG

Peptide

LQCGRASSALTPLSSIR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page