top of page

CircRNA

Gene

chr5|151060317|151063747|—|3|circRNA|TNIP1|NM_001258455|4,3,2

TNIP1

Open Reading Frame (ORF)

LNLKWSLLRSRIHQRAAAMPMRWGAFGRVPDGSDQAPAEGRGASEGQRAAPTTFSLLGLLRPPG

Peptide

AAAMPMRWGAFGR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page