top of page

CircRNA

Gene

chr5|151049823|151063747|—|6|circRNA|TNIP1|NM_001258455|7,6,5,4,3,2

TNIP1

Open Reading Frame (ORF)

LELKKLLMSNGNKEGASGRPGSPKMEGTGKKAVAGQQQGSFWKSPRWKRPGSGRRQRS

Peptide

AVAGQQQGSFWKSPR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page