top of page

CircRNA

Gene

chr5|150446801|150447735|-|2|circRNA|RPS14|ENST00000401695.7|3,2

RPS14

CircRNA UID

circRPS14(3,2)

Open Reading Frame (ORF)

MKVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNRNGTSKGEGKEGRTGHQPRTSGG

Peptide

EGRTGHQPR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page