top of page

CircRNA

Gene

chr5|149836262|149842377|+|3|circRNA|PPARGC1B|NM_001172698|7,8,9

PPARGC1B

Open Reading Frame (ORF)

MSSRELKRRFEVFGEIEECEVLTRNRRTHPTHHTTVQAHRGGSLQTRHQA

Peptide

GGSLQTR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page