top of page

CircRNA

Gene

chr5|143310096|143400852|—|3|circRNA|NR3C1|NM_000176|4,3,2

NR3C1

Open Reading Frame (ORF)

MKTVCFLLWREKTIHSFWKETRMRTASLSFYRTLNPKLRIMEIWFCQAPVM

Peptide

TASLSFYR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page