top of page

CircRNA

Gene

chr5|14290715|14316743|+|5|circRNA|TRIO|ENST00000344204.8|5,6,7,8,9

TRIO

CircRNA UID

circTRIO(5,6,7,8,9)

Open Reading Frame (ORF)

LATPQGPAASEAAAVCFPAGRSADKYGLFRRPYQSS

Peptide

LATPQGPAASEAAAVCFPAGR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA,PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

riboCIRC,TranCirc

Potential Cryptic Translation

false

bottom of page