top of page

CircRNA

Gene

chr5|140485120|140529796|+|18|circRNA|ANKHD1|ENST00000297183.10|12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29

ANKHD1

Open Reading Frame (ORF)

LSPLHLSLAGKLPPHFYLQVLLKHSFLHKRWSLSLLCHPPKRKCPHRTSPWQTYVPHLQLQTVAVALPATPRELQKLTHPVVPLLLPVTHKRRHSHPVCLI

Peptide

LSPLHLSLAGKLPPHFYLQVLLK

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page