top of page

CircRNA

Gene

chr5|140167364|140167802|+|2|circRNA|CTB—131B5.5|ENST00000523154.5|3,4

CTB-131B5.5

Open Reading Frame (ORF)

MPTSSMARCWSAPAAASLVAFIKGLCFFGYDTKRSC

Peptide

GLCFFGYDTKR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page