top of page

CircRNA

Gene

chr5|138372673|138415239|+|11|circRNA|KDM3B|ENST00000314358.9|2,3,4,5,6,7,8,9,10,11,12

KDM3B

Open Reading Frame (ORF)

MGDEEVFSWLKCAKGQSHEPENLMPTQIIPGTDLCRI

Peptide

CAKGQSHEPENLMPTQIIPGTDLCR

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page