top of page

CircRNA

Gene

chr5|132886309|132897240|-|8|circRNA|AFF4|ENST00000265343.9|18,17,16,15,14,13,12,11

AFF4

CircRNA UID

circAFF4(18,17,16,15,14,13,12,11)

Open Reading Frame (ORF)

MKVRAFLLPHKLLSTPRAIGLLLNPPQWRKKIAFFGNECSLLWKRRNFFHPSVSLMTGTHLL

Peptide

AFLLPHK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA,PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

true

bottom of page