top of page

CircRNA

Gene

chr5|132823249|132826182|-|6|circRNA|SHROOM1|ENST00000378679.7|9,8,7,6,5,4

SHROOM1

Open Reading Frame (ORF)

LAFCCCWAVAWRACAAPWPGRPQTATLMSRTHAATQPQHSSAQPWRPWDLGATAPPRPRPLAAWTCGICPCARTRPTALSPQPPAAPSRARSRRGQTSFLT

Peptide

TRPTALSPQPPAAPSRAR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page