top of page

CircRNA

Gene

chr5|1324854|1325750|—|1|ciRNA|CLPTM1L|ENST00000320895.9|10

CLPTM1L

Open Reading Frame (ORF)

LGLSRPLGGRMLAGQHVCFVLAPCPEALPRLVLTGVRTVLAVLK

Peptide

LGLSRPLGGR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA,PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page