top of page

CircRNA

Gene

chr5|1323869|1324762|-|1|ciRNA|CLPTM1L|ENST00000320895.9|11

CLPTM1L

CircRNA UID

ciCLPTM1L(11)

Open Reading Frame (ORF)

MPCLCPSRRPLQSSPATLSAVARSVCPCRGELHAVCLQRLGVWASNWKPSLFPAGKSLVIQGTCMPGKSNTLKDGSFTVIAQCGSLLGVRVSPP

Peptide

LGVWASNWKPSLFPAGK

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page