top of page

CircRNA

Gene

chr5|131489545|131548190|-|10|circRNA|RAPGEF6|ENST00000509018.5|15,14,13,12,11,10,9,8,7,6

RAPGEF6

CircRNA UID

circRAPGEF6(15,14,13,12,11,10,9,8,7,6)

Open Reading Frame (ORF)

MEVNGQNFENITFMKAVEILRNNTHLALTVKTNIFGRECQR

Peptide

NNTHLALTVKTNIFGR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page