top of page

CircRNA

Gene

chr5|131464040|131479753|—|3|circRNA|RAPGEF6|ENST00000509018.5|18,17,16

RAPGEF6

Open Reading Frame (ORF)

LTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGSVQRVTF

Peptide

IQLNGSVQR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page