top of page

CircRNA

Gene

chr5|131439580|131456012|—|5|circRNA|RAPGEF6|ENST00000509018.5|24,23,22,21,20

RAPGEF6

Open Reading Frame (ORF)

LWRHLYILVLLHLLKAPLTKWLEPGICSKTQRNLGKVTKQIRETSSRSTRHF

Peptide

TQRNLGK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page