top of page

CircRNA

Gene

chr5|124639132|124644661|—|4|circRNA|ZNF608|ENST00000504926.5|8,7,6,5

ZNF608

Open Reading Frame (ORF)

LLPLLPLSRWLPRHLHLECFLDKEGPRFKNMASLCIPAQISGSAKVRRT

Peptide

NMASLCIPAQISGSAK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page