top of page

CircRNA

Gene

chr5|122422867|122432082|+|2|circRNA|SNCAIP|ENST00000509154.6|5,6

SNCAIP

CircRNA UID

circSNCAIP(5,6)

Open Reading Frame (ORF)

MKVMTKRTRKWLSTRKGVSLTWAPSLRSLALEMEWAAHQVRALSPAHRWVNWSTTTSTWMRFWMCLILNPVSSLPLLPR

Peptide

FWMCLILNPVSSLPLLPR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page