top of page

CircRNA

Gene

chr5|109729341|109767708|+|3|circRNA|MAN2A1|ENST00000261483.4|4,5,6

MAN2A1

Open Reading Frame (ORF)

LDFLTCLSREFIMQLKNTLHCIKHWSFFGDRIGVG

Peptide

HWSFFGDRIGVG

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page