top of page

CircRNA

Gene

chr5|109713519|109716264|+|2|circRNA|MAN2A1|ENST00000261483.4|2,3

MAN2A1

CircRNA UID

circMAN2A1(2,3)

Open Reading Frame (ORF)

MLDVYSLISFDNPDGGVWKQGFDITYESNEWDTEPLQVFVVPHSHNDPGPALNVARKNRPFGAFAS

Peptide

QGFDITYESNEWDTEPLQVFVVPHSHNDPGPALNVAR

ORF Found in Long-Read

false

Peptide Length

37

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

30

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page