top of page

CircRNA

Gene

chr5|103136731|103146681|+|3|circRNA|PPIP5K2|ENST00000321521.13|4,5,6

PPIP5K2

Open Reading Frame (ORF)

LIEGEDHVEVNGEVFQKPFVEKPVSAEDHNVYIYYPTSAGGGSQRLFRKDFHWTKRLPMQNSGIHL

Peptide

LPMQNSGIHL

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page