top of page

CircRNA

Gene

chr4|87178476|87195690|-|4|circRNA|KLHL8|ENST00000273963.9|5,4,3,2

KLHL8

CircRNA UID

circKLHL8(5,4,3,2)

Open Reading Frame (ORF)

LFCVGGRGGSGDPFRSIECYSINKNSWFFGPEMNSRRRHVGVISVEVTANCTMAVEWVLKNV

Peptide

HVGVISVEVTANCTMAVEWVLK

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

14

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page