top of page

CircRNA

Gene

chr4|87105627|87115299|+|4|circRNA|AFF1|ENST00000395146.8|9,10,11,12

AFF1

Open Reading Frame (ORF)

LRHQRAPGAQSPHGGTQRVRAAATVPRVRSILNPKILPLKAPAKPPGPHPKPPTPERGAVRSLRHSRSPHKGKPLEPNNPKNLSRPLPGQVHGPACRGKGSQGFFPMAPETRLPKTSPR

Peptide

AAATVPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116,PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page