top of page

CircRNA

Gene

chr4|8231975|8237670|+|4|circRNA|SH3TC1|ENST00000506360.5|12,13,14,15

SH3TC1

Open Reading Frame (ORF)

LPGPTLCQSSASRSAGQEPKQLPDFPGLLSRQAHLPSWLPRPAVGHSPRSFTQCRAPCLAELCFLCLFPLLTTRAAQCALCLPDMPDISLVPACARLSGTFPFSCALPTLINHTALWLMKSQFPFQQPAP

Peptide

SAGQEPKQLPDFPGLLSR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page