top of page

CircRNA

Gene

chr4|7786193|7800653|-|3|circRNA|AFAP1|NM_001134647|12,11,10

AFAP1

Open Reading Frame (ORF)

MPTPAGRHFIMTMSRASTARLSERALQQPLARALVPSER

Peptide

MPTPAGRHFIMTMSR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page