top of page

CircRNA

Gene

chr4|76995780|77020670|+|7|circRNA|SEPT11|NM_001306147|3,4,5,6,7,8,9

45180

Open Reading Frame (ORF)

MNCTDAVSLKRWGSRTLTLTANPSVYIGKLCKTPAVTEPVLGATG

Peptide

LCKTPAVTEPVLGATG

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page