top of page

CircRNA

Gene

chr4|76396268|76403280|—|2|circRNA|CCDC158|ENST00000504868.1|4,3

CCDC158

Open Reading Frame (ORF)

LTQVPFFPKYEVELDSPRKIIPSPGKEHFERVLEEYSHQVKDLQRRLNETGTKRTKEGTIHTSRSLIRSSNI

Peptide

EGTIHTSR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page