top of page

CircRNA

Gene

chr4|75646337|75648741|—|3|circRNA|G3BP2|NM_012297|11,10,9

G3BP2

Open Reading Frame (ORF)

LETLWNFASIPRVLGESFQILVLWFLMTLNQFRES

Peptide

LETLWNFASIPR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page