top of page

CircRNA

Gene

chr4|73409362|73413510|+|1|ciRNA|ALB|ENST00000621085.4|5

ALB

Open Reading Frame (ORF)

LVACMLKLVEWMRLVSLVIADSGLRLSSVLSSVLSSIFPCLWWWYLSVFNLAINYQINPFTDL

Peptide

LVSLVIADSGLR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page