top of page

CircRNA

Gene

chr4|73405115|73408805|+|3|circRNA|ALB|ENST00000441319.5|3,4,5

ALB

Open Reading Frame (ORF)

LETNYAQLQLFVKPMVKWLTAVQNKNLREMNASCNTKMTTQTSPDW

Peptide

WLTAVQNK

ORF Found in Long-Read

true

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page