top of page

CircRNA

Gene

chr4|71447645|71497692|+|8|circRNA|SLC4A4|ENST00000264485.9|9,10,11,12,13,14,15,16

SLC4A4

CircRNA UID

circSLC4A4(9,10,11,12,13,14,15,16)

Open Reading Frame (ORF)

LSKKECSKYGGNLVGNNCNFVPDITLMSFILFLGTYTSSMALKKFKTSPYFPTTVLVHSLRS

Peptide

FKTSPYFPTTVLVHSLR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page