top of page

CircRNA

Gene

chr4|70831538|70833273|—|3|circRNA|GRSF1|NM_001098477|5,4,3

GRSF1

Open Reading Frame (ORF)

LNIVDITFVMDYRGRRKTGEAYVQFEEPEMANQALLKHREEIGNRLQNPQR

Peptide

EEIGNRLQNPQR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page